Inhibin beta A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A25230
Artikelname: Inhibin beta A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A25230
Hersteller Artikelnummer: A25230
Alternativnummer: ABB-A25230-20UL,ABB-A25230-100UL,ABB-A25230-500UL,ABB-A25230-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: EDF, FRP, Inhibin beta A (INHBA)
This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. The encoded protein also plays a role in eye, tooth and testis development. Elevated expression of this gene may be associated with cancer cachexia in human patients.
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 3624
UniProt: P08476
Reinheit: Affinity purification
Sequenz: MPLLWLRGFLLASCWIIVRSSPTPGSEGHSAAPDCPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALLNAIRKLHVGKVGENGY
Target-Kategorie: INHBA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Growth factors,Immunology Inflammation,Cytokines. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver usingInhibin beta A Rabbit pAb (A25230) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.