MRPL36 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A25244
Artikelname: MRPL36 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A25244
Hersteller Artikelnummer: A25244
Alternativnummer: ABB-A25244-100UL,ABB-A25244-20UL,ABB-A25244-500UL,ABB-A25244-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RPMJ, BRIP1, L36mt, bL36m, PRPL36, MRP-L36
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 2p.
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 64979
UniProt: Q9P0J6
Reinheit: Affinity purification
Sequenz: PVAVEPGAAVRSLLSPGLLPHLLPALGFKNKTVLKKRCKDCYLVKRRGRWYVYCKTHPRHKQRQM
Target-Kategorie: MRPL36
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Tags & Cell Markers,Subcellular Markers,Organelles,Mitochondria,Epigenetics and Nuclear Signaling,DNA / RNA,Translation,Mito. Translation. Shipping: Ice Bag
Western blot analysis of lysates from RT4 cells usingMRPL36 Rabbit pAb (A25244) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.