ID2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A25251
Artikelname: ID2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A25251
Hersteller Artikelnummer: A25251
Alternativnummer: ABB-A25251-100UL,ABB-A25251-20UL,ABB-A25251-1000UL,ABB-A25251-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GIG8, ID2A, ID2H, bHLHb26, ID2
The protein encoded by this gene belongs to the inhibitor of DNA binding family, members of which are transcriptional regulators that contain a helix-loop-helix (HLH) domain but not a basic domain. Members of the inhibitor of DNA binding family inhibit the functions of basic helix-loop-helix transcription factors in a dominant-negative manner by suppressing their heterodimerization partners through the HLH domains. This protein may play a role in negatively regulating cell differentiation. A pseudogene of this gene is located on chromosome 3.
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 3398
UniProt: Q02363
Reinheit: Affinity purification
Sequenz: MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASR
Target-Kategorie: ID2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from NK-92 cells using ID2 Rabbit pAb (A25251) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.