IL33 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: IL33 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25253
• Hersteller Artikelnummer: A25253
• Alternativnummer: ABB-A25253-20UL,ABB-A25253-100UL,ABB-A25253-500UL,ABB-A25253-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Il-33, Il1f11, NF-HEV, 9230117N10Rik, IL-33

Produktbeschreibung

Enables cytokine activity and interleukin-33 receptor binding activity. Involved in several processes, including interleukin-33-mediated signaling pathway, microglial cell activation involved in immune response, and regulation of gene expression. Acts upstream of or within several processes, including negative regulation of macrophage proliferation, positive regulation of cellular defense response, and positive regulation of macromolecule metabolic process. Located in nucleus. Is expressed in several structures, including adrenal gland, alimentary system, genitourinary system, nervous system, and sensory organ. Used to study Alzheimers disease. Human ortholog(s) of this gene implicated in candidiasis, inflammatory bowel disease, and peptic ulcer disease. Orthologous to human IL33 (interleukin 33).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 30kDa
• NCBI: 77125
• UniProt: Q8BVZ5
• Reinheit: Affinity purification
• Sequenz: SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
• Target-Kategorie: Il33
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cardiovascular,Angiogenesis,Cytokines,Immunology,Innate Immunity,Cytokines,Interleukins. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from wild type (WT) and293F cells transfected withIL33 usingIL33 Rabbit pAb (A25253) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 40.5µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:45s.