CCL3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CCL3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25292
• Hersteller Artikelnummer: A25292
• Alternativnummer: ABB-A25292-100UL,ABB-A25292-20UL,ABB-A25292-1000UL,ABB-A25292-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: MIP1A, SCYA3, G0S19-1, LD78ALPHA, MIP-1-alpha, CCL3

Produktbeschreibung

This locus represents a small inducible cytokine. The encoded protein, also known as macrophage inflammatory protein 1 alpha, plays a role in inflammatory responses through binding to the receptors CCR1, CCR4 and CCR5. Polymorphisms at this locus may be associated with both resistance and susceptibility to infection by human immunodeficiency virus type 1.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 10kDa
• NCBI: 6348
• UniProt: P10147
• Reinheit: Affinity purification
• Sequenz: ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
• Target-Kategorie: CCL3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of Recombinant Human CCL3/MIP-1 alpha Protein (RP01628) using CCL3 Rabbit pAb (A25292) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 5 ng/2ng/1ng per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.