[KD Validated] Argonaute-2 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: [KD Validated] Argonaute-2 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A25642
• Hersteller Artikelnummer: A25642
• Alternativnummer: ABB-A25642-500UL,ABB-A25642-20UL,ABB-A25642-100UL,ABB-A25642-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PPD, Q10, CASC7, EIF2C2, LESKRES, LINC00980

Produktbeschreibung

This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Molekulargewicht: 97kDa
• NCBI: 27161
• UniProt: Q9UKV8
• Reinheit: Affinity purification
• Sequenz: YTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWF
• Target-Kategorie: AGO2

Anwendungsbeschreibung

• Application Verdünnung: WB,1:2000 - 1:8000|IHC-P,1:600 - 1:6000|IF/ICC,1:300 - 1:1200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Nuclear Receptor Signaling.

Bilder

Western blot analysis of various lysates using [KD Validated] Argonaute-2 Rabbit mAb (A25642) at 1:2900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:30s.

Immunohistochemistry analysis of paraffin-embeddedMouse testis tissue using[KD Validated] Argonaute-2 Rabbit mAb(A25642) at a dilution of1:600 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Western blot analysis of lysates from wild type (WT) and Argonaute-2 knockdown (KD)HeLa cellsusing[KD Validated] Argonaute-2 Rabbit mAb (A25642) at1:2900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:30s.

Immunohistochemistry analysis of paraffin-embeddedRat testis tissue using[KD Validated] Argonaute-2 Rabbit mAb(A25642) at a dilution of1:600 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedHuman liver cancer tissue using[KD Validated] Argonaute-2 Rabbit mAb(A25642) at a dilution of1:600 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embeddedHuman kidney tissue using[KD Validated] Argonaute-2 Rabbit mAb(A25642) at a dilution of1:600 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Confocal imaging of Hep G2 cells using[KD Validated] Argonaute-2 Rabbit mAb (A25642, dilution 1:300) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of NIH/3T3 cells using[KD Validated] Argonaute-2 Rabbit mAb (A25642, dilution 1:300) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of PC-12 cells using[KD Validated] Argonaute-2 Rabbit mAb (A25642, dilution 1:300) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.