IGF2BP1/IMP1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: IGF2BP1/IMP1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A25715
• Hersteller Artikelnummer: A25715
• Alternativnummer: ABB-A25715-1000UL,ABB-A25715-20UL,ABB-A25715-100UL,ABB-A25715-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: IMP1, ZBP1, CRDBP, IMP-1, CRD-BP, VICKZ1

Produktbeschreibung

This gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including insulin-like growth factor 2, beta-actin and beta-transducin repeat-containing protein, and regulating their translation. Two transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Molekulargewicht: 49kDa/63kDa
• NCBI: 10642
• UniProt: Q9NZI8
• Reinheit: Affinity purification
• Sequenz: LAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRL
• Target-Kategorie: IGF2BP1

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|IF/ICC,1:200 - 1:800|IP,0.5µg-4µg antibody for 400µg-600µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling, RNA Binding, Nuclear Receptor Signaling.

Bilder

Western blot analysis of lysates from NIH/3T3 cells using IGF2BP1/IMP1 Rabbit mAb (A25715) at 1:1000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of lysates from Rat testis using IGF2BP1/IMP1 Rabbit mAb (A25715) at 1:1000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of various lysates using IGF2BP1/IMP1 Rabbit mAb (A25715) at 1:1000 dilutionincubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): U-937
Exposure time: 1s.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using IGF2BP1/IMP1 Rabbit mAb (A25715) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using IGF2BP1/IMP1 Rabbit mAb (A25715) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human testis tissue using IGF2BP1/IMP1 Rabbit mAb (A25715) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat testis tissue using IGF2BP1/IMP1 Rabbit mAb (A25715) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Confocal imaging of Hep G2 cells using IGF2BP1/IMP1 Rabbit mAb (A25715, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunoprecipitation of IGF2BP1/IMP1 from 500 µg extracts of 293F cells was performed using 2 µg of IGF2BP1/IMP1 Rabbit mAb (A25715). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X non-reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using IGF2BP1/IMP1 Rabbit mAb (A25715) at a dilution of 1:1000.