CD304 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CD304 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25754
• Hersteller Artikelnummer: A25754
• Alternativnummer: ABB-A25754-20UL,ABB-A25754-1000UL,ABB-A25754-500UL,ABB-A25754-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Nrp, NP-1, Npn1, NPN-1, C530029I03

Produktbeschreibung

Enables protein kinase binding activity, transmembrane signaling receptor activity, and vascular endothelial growth factor binding activity. Involved in several processes, including nervous system development, regulation of signal transduction, and vasculature development. Acts upstream of or within several processes, including morphogenesis of a branching epithelium, nervous system development, and toxin transport. Located in several cellular components, including endosome, focal adhesion, and neurofilament. Is integral component of postsynaptic membrane. Is expressed in several structures, including cardiovascular system, jaw, lung, nervous system, and sensory organ. Used to study retinal vein occlusion. Human ortholog(s) of this gene implicated in lung non-small cell carcinoma. Orthologous to human NRP1 (neuropilin 1).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 103kDa
• NCBI: 18186
• UniProt: P97333
• Reinheit: Affinity purification
• Sequenz: FRSDKCGGTIKIENPGYLTSPGYPHSYHPSEKCEWLIQAPEPYQRIMINFNPHFDLEDRDCKYDYVEVIDGENEGGRLWGKFCGKIAPSPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTAPTGVIKSPGFPEKYPNSLECTYIIFAPKMSEIILEFESFDLEQDSNPPGGMFCRYDRLEIWDGFPEVGPHIGRYCGQKTPGRIRSSSGVLSMVFYTDSAIAKEGFSANYSVLQSSISEDFKCM
• Target-Kategorie: Nrp1

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cardiovascular Angiogenesis Growth Factors VEGF VEGF ReceptorsNeuroscience Neurology process Growth and Development Axonal Guidance ProteinsImmunology Adaptive Immunity Regulatory T Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CD304 Rabbit pAb (A25754) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020)
Exposure time: 30 s.