Lif Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Lif Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25755
• Hersteller Artikelnummer: A25755
• Alternativnummer: ABB-A25755-100UL,ABB-A25755-20UL,ABB-A25755-500UL,ABB-A25755-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated

Produktbeschreibung

Enables cytokine activity and growth factor activity. Acts upstream of or within several processes, including animal organ development, generation of neurons, and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in several structures, including alimentary system, central nervous system, cranium, early conceptus, and female reproductive system. Orthologous to human LIF (LIF interleukin 6 family cytokine).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 22kDa
• NCBI: 16878
• UniProt: P09056
• Reinheit: Affinity purification
• Sequenz: SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
• Target-Kategorie: Lif

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology Innate Immunity Cytokines IL6 RelatedImmunology Innate Immunity Cytokines OtherCell Biology Cell Cycle Cell differentiationNeuroscience Neurology process NeurogenesisEpigenetics and Nuclear Signaling Transcription Cancer susceptibility Tumor SuppressorsCancer Cell cycle Cell differentiation. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using Lif Rabbit pAb (A25755) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 40s.