Prion Protein Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2583
- Bilder (1)
| Artikelname: | Prion Protein Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2583 |
| Hersteller Artikelnummer: | A2583 |
| Alternativnummer: | ABB-A2583-1000UL,ABB-A2583-100UL,ABB-A2583-20UL,ABB-A2583-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CJD, GSS, PrP, ASCR, KURU, PRIP, PrPc, CD230, AltPrP, p27-30, PrP27-30, PrP33-35C, Prion Protein |
| The protein encoded by this gene is a membrane glycosylphosphatidylinositol-anchored glycoprotein that tends to aggregate into rod-like structures. The encoded protein contains a highly unstable region of five tandem octapeptide repeats. This gene is found on chromosome 20, approximately 20 kbp upstream of a gene which encodes a biochemically and structurally similar protein to the one encoded by this gene. Mutations in the repeat region as well as elsewhere in this gene have been associated with Creutzfeldt-Jakob disease, fatal familial insomnia, Gerstmann-Straussler disease, Huntington disease-like 1, and kuru. An overlapping open reading frame has been found for this gene that encodes a smaller, structurally unrelated protein, AltPrp. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 28kDa |
| NCBI: | 5621 |
| UniProt: | P04156 |
| Reinheit: | Affinity purification |
| Sequenz: | KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRGS |
| Target-Kategorie: | PRNP |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Immunology Inflammation,CDs,Neuroscience,Neurodegenerative Diseases,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag |

