MAPKBP1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A2626
Artikelname: MAPKBP1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A2626
Hersteller Artikelnummer: A2626
Alternativnummer: ABB-A2626-500UL,ABB-A2626-20UL,ABB-A2626-1000UL,ABB-A2626-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: JNKBP1, NPHP20, JNKBP-1, MAPKBP1
This gene encodes a scaffold protein that regulates the JNK (c-Jun N-terminal kinase) and NOD2 (nucleotide-binding oligomerization domain-containing protein 2) signaling pathways. The encoded protein interacts with another related JNK pathway scaffold protein, WDR62, via a conserved dimerization domain, and enhances JNK signaling. This protein may play a role in bacterial immunity by binding to the NOD2 receptor and negatively regulating downstream antibacterial and pro-inflammatory signaling. Mutations in this gene that impair cellular localization of the encoded protein cause a form of nephronophthisis, an autosomal-recessive kidney disorder, in human patients.
Klonalität: Polyclonal
Molekulargewicht: 164kDa
NCBI: 23005
UniProt: O60336
Reinheit: Affinity purification
Sequenz: MAVEGSTITSRIKNLLRSPSIKLRRSKAGNRREDLSSKVTLEKVLGITVSGGRGLACDPRSGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSP
Target-Kategorie: MAPKBP1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Kinase. Shipping: Ice Bag
Western blot analysis of various lysates using MAPKBP1 Rabbit pAb (A2626) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.