GOLPH2 Rabbit PolymAb, Unconjugated

Artikelnummer: ABB-A26409PM
Artikelname: GOLPH2 Rabbit PolymAb, Unconjugated
Artikelnummer: ABB-A26409PM
Hersteller Artikelnummer: A26409PM
Alternativnummer: ABB-A26409PM-100UL,ABB-A26409PM-20UL,ABB-A26409PM-500UL,ABB-A26409PM-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GP73, HEL46, GOLPH2, C9orf155, PSEC0257, bA379P1.3
The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene.
Molekulargewicht: 45kDa
NCBI: 51280
UniProt: Q8NBJ4
Reinheit: Affinity purification
Sequenz: VEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD
Target-Kategorie: GOLM1
Application Verdünnung: WB,1:1000 - 1:3000|IF/ICC,1:1000 - 1:4000|IF-P,1:1000 - 1:4000|IHC-P,1:5000 - 1:20000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using GOLPH2 Rabbit PolymAb (A26409PM) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Western blot analysis of various lysates using GOLPH2 Rabbit PolymAb (A26409PM) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using GOLPH2 Rabbit PolymAb (A26409PM) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using GOLPH2 Rabbit PolymAb (A26409PM) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using GOLPH2 Rabbit PolymAb (A26409PM) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using GOLPH2 Rabbit PolymAb (A26409PM) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Confocal imaging of HeLa cells using GOLPH2 Rabbit PolymAb (A26409PM, dilution 1:2000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of A-431 cells using GOLPH2 Rabbit PolymAb (A26409PM, dilution 1:2000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of paraffin-embedded Mouse colon tissue using GOLPH2 Rabbit PolymAb (A26409PM, dilution 1:2000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.