COX6B1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: COX6B1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2641
• Hersteller Artikelnummer: A2641
• Alternativnummer: ABB-A2641-100UL,ABB-A2641-1000UL,ABB-A2641-500UL,ABB-A2641-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: COXG, COX6B, MC4DN7, COXVIb1, COX6B1

Produktbeschreibung

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 10kDa
• NCBI: 1340
• UniProt: P14854
• Reinheit: Affinity purification
• Sequenz: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
• Target-Kategorie: COX6B1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using COX6B1 Rabbit pAb (A2641) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.