Cytokeratin AE1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Cytokeratin AE1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A26614
• Hersteller Artikelnummer: A26614
• Alternativnummer: ABB-A26614-500UL,ABB-A26614-1000UL,ABB-A26614-100UL,ABB-A26614-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: BIE, EHK, IHL, K10, KPP, BCIE, CK10

Produktbeschreibung

This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in this gene are associated with epidermolytic hyperkeratosis. This gene is located within a cluster of keratin family members on chromosome 17q21.

Produkteigenschaften

• Molekulargewicht: 59kDa/52kDa/49kDa/51kDa/44kDa
• NCBI: 3858
• UniProt: P13645
• Reinheit: Affinity purification
• Sequenz: IFGGGSFGGGSFGGGSFGGGGFGGGGFGGGFGGGFGGDGGLLSGNEKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRDYSKYY
• Target-Kategorie: Cytokeratin AE1

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:100 - 1:400|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Keratin.

Bilder

Immunohistochemistry analysis of paraffin-embedded human breast cancer tissue using Cytokeratin AE1 Rabbit pAb (A26614) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded human esophagus tissue using Cytokeratin AE1 Rabbit pAb (A26614) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Western blot analysis of lysates from Mouse colon using Cytokeratin AE1 Rabbit pAb (A26614) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Immunohistochemistry analysis of paraffin-embedded human kidney tissue using Cytokeratin AE1 Rabbit pAb (A26614) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded human tonsil tissue using Cytokeratin AE1 Rabbit pAb (A26614) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded mouse colon tissue using Cytokeratin AE1 Rabbit pAb (A26614) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded mouse skin tissue using Cytokeratin AE1 Rabbit pAb (A26614) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded rat colon tissue using Cytokeratin AE1 Rabbit pAb (A26614) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded rat skin tissue using Cytokeratin AE1 Rabbit pAb (A26614) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.