CD11b Rabbit PolymAb, Unconjugated

Produktübersicht

• Artikelname: CD11b Rabbit PolymAb, Unconjugated
• Artikelnummer: ABB-A26754PM
• Hersteller Artikelnummer: A26754PM
• Alternativnummer: ABB-A26754PM-1000UL,ABB-A26754PM-500UL,ABB-A26754PM-20UL,ABB-A26754PM-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CR3A, MO1A, CD11B, MAC-1, MAC1A, SLEB6

Produktbeschreibung

This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 (Mac-1), or inactivated-C3b (iC3b) receptor 3 (CR3). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Molekulargewicht: 127kDa
• NCBI: 3684
• UniProt: P11215
• Reinheit: Affinity purification
• Sequenz: MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPP
• Target-Kategorie: ITGAM

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:6000|IHC-P,1:200 - 1:800|IF/ICC,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,PI3K-Akt Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Adhesion,Cytoskeleton,Immunology Inflammation,CDs,Neuroscience, Cell T

Bilder

Western blot analysis of various lysates using CD11b Rabbit PolymAb (A26754PM) at 1:1000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Jurkat
Exposure time: 30s.

Western blot analysis of various lysates using CD11b Rabbit PolymAb (A26754PM) at 1:1000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): C2C12
Exposure time: 1s.

Western blot analysis of lysates from Rat spleen using CD11b Rabbit PolymAb (A26754PM) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CD11b Rabbit PolymAb (A26754PM) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using CD11b Rabbit PolymAb (A26754PM) at a dilution of 1:400 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of RAW 264.7 cells using CD11b Rabbit PolymAb (A26754PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of TF-1 cells using CD11b Rabbit PolymAb (A26754PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.