Aurora B Mouse mAb, Unconjugated

Produktübersicht

• Artikelname: Aurora B Mouse mAb, Unconjugated
• Artikelnummer: ABB-A26775
• Hersteller Artikelnummer: A26775
• Alternativnummer: ABB-A26775-1000UL,ABB-A26775-20UL,ABB-A26775-100UL,ABB-A26775-500UL
• Hersteller: ABclonal
• Wirt: Mouse
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: AIK2, AIM1, ARK2, AurB, IPL1, STK5, AIM-1, ARK-2, STK-1, STK12, PPP1R48, aurkb-sv1, aurkb-sv2

Produktbeschreibung

This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 19 and 20. These kinases participate in the regulation of alignment and segregation of chromosomes during mitosis and meiosis through association with microtubules. A pseudogene of this gene is located on chromosome 8. Alternatively spliced transcript variants have been found for this gene.

Produkteigenschaften

• Molekulargewicht: 39kDa
• NCBI: 9212
• UniProt: Q96GD4
• Reinheit: Affinity purification
• Sequenz: MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH
• Target-Kategorie: AURKB

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:2000|IHC-P,1:200 - 1:800|IF/ICC,1:800 - 1:3200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Cancer,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology,Cell Cycle,Microtubules.

Bilder

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using Aurora B Mouse mAb (A26775) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using Aurora B Mouse mAb (A26775) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Western blot analysis of various lysates using Aurora B Mouse mAb (A26775) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Mouse IgG (H+L) (AS003) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Aurora B Mouse mAb (A26775) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using Aurora B Mouse mAb (A26775) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.

Confocal imaging of HeLa cells using Aurora B Mouse mAb (A26775, dilution 1:1600) followed by a further incubation with Cy3-conjugated Goat anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of PC-12 cells using Aurora B Mouse mAb (A26775, dilution 1:1600) followed by a further incubation with Cy3-conjugated Goat anti-Mouse IgG (H+L) (AS008, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.