CD74 Rabbit PolymAb, Unconjugated

Produktübersicht

• Artikelname: CD74 Rabbit PolymAb, Unconjugated
• Artikelnummer: ABB-A26945PM
• Hersteller Artikelnummer: A26945PM
• Alternativnummer: ABB-A26945PM-100UL,ABB-A26945PM-1000UL,ABB-A26945PM-20UL,ABB-A26945PM-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human, Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: II, p33, CLIP, DHLAG, HLADG, Ia-GAMMA

Produktbeschreibung

The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

Produkteigenschaften

• Molekulargewicht: 24kDa/26kDa
• NCBI: 972
• UniProt: P04233
• Reinheit: Affinity purification
• Sequenz: QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
• Target-Kategorie: CD74

Anwendungsbeschreibung

• Application Verdünnung: WB,1:5000 - 1:20000|IF/ICC,1:200 - 1:800|IF-P,1:200 - 1:800|IHC-P,1:4000 - 1:16000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs.

Bilder

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using CD74 Rabbit PolymAb (A26945PM) at a dilution of 1:9000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates using CD74 Rabbit PolymAb (A26945PM) at 1:5000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Jurkat
Exposure time: 30s.

Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using CD74 Rabbit PolymAb (A26945PM) at a dilution of 1:9000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of Raji cells using CD74 Rabbit PolymAb (A26945PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of THP-1 cells using CD74 Rabbit PolymAb (A26945PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of A20 cells using CD74 Rabbit PolymAb (A26945PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of paraffin-embedded Mouse thymus tissue using CD74 Rabbit PolymAb (A26945PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.