CDX4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2704
- Bilder (1)
| Artikelname: | CDX4 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2704 |
| Hersteller Artikelnummer: | A2704 |
| Alternativnummer: | ABB-A2704-20UL,ABB-A2704-500UL,ABB-A2704-1000UL,ABB-A2704-100UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CDX4 |
| This gene encodes a member of a small subfamily of homeobox containing transcription factors. The encoded protein may regulate homeobox gene expression during anteroposterior patterning and hematopoiesis. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 30kDa |
| NCBI: | 1046 |
| UniProt: | O14627 |
| Reinheit: | Affinity purification |
| Sequenz: | MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMPSMDPHWPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKT |
| Target-Kategorie: | CDX4 |
| Application Verdünnung: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag |

