HSF2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2747
- Bilder (1)
| Artikelname: | HSF2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2747 |
| Hersteller Artikelnummer: | A2747 |
| Alternativnummer: | ABB-A2747-100UL,ABB-A2747-20UL,ABB-A2747-500UL,ABB-A2747-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HSF 2, HSTF 2, HSF2 |
| The protein encoded by this gene belongs to the HSF family of transcription factors that bind specifically to the heat-shock promoter element and activate transcription. Heat shock transcription factors activate heat-shock response genes under conditions of heat or other stresses. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 60kDa |
| NCBI: | 3298 |
| UniProt: | Q03933 |
| Reinheit: | Affinity purification |
| Sequenz: | LDEQRFAKEILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFKQGQDDLLENIKRKVSSSKPEENKIRQEDLTKIISSAQKVQIKQETIESRLSELKSENESLWKEVSELRAKHAQQQQVIRKIVQFIVTLVQNNQLVSLKRKRPLLLNTNGAQKKNLFQH |
| Target-Kategorie: | HSF2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |

