APC Rabbit anti-Mouse FOXP3 mAb, Monoclonal

Artikelnummer: ABB-A27564
Artikelname: APC Rabbit anti-Mouse FOXP3 mAb, Monoclonal
Artikelnummer: ABB-A27564
Hersteller Artikelnummer: A27564
Alternativnummer: ABB-A27564-25UG,ABB-A27564-100UG
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC
Spezies Reaktivität: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: APC
Alternative Synonym: sf, JM2, scurfin
The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene result in the scurfy phenotype (sf). Alternative splicing results in multiple transcript variants.
Klonalität: Monoclonal
Konzentration: FC (intra)
Molekulargewicht: 47kDa
NCBI: 20371
UniProt: Q99JB6
Reinheit: Affinity purification
Sequenz: MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPTVPLVMVAPSGARLGPSPHLQALLQDRPH
Target-Kategorie: Foxp3
Application Verdünnung: FC (intra),0.25 µg per million cells in 100 µl volume
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cell Biology Cell Cycle Cell Division Chromatid CohesionEpigenetics and Nuclear Signaling Transcription Domain Families Forkhead Box FOXPImmunology Adaptive Immunity Regulatory T Cells. Shipping: Ice Bag
Flow cytometry:1X10 6 C57BL/6 mouse splenocytes were surface-stained with PE Rabbit anti-Mouse CD4 mAb (A25933,5 µl/Test) and then intracellularly-stained with APC Rabbit IgG isotype control (A24173,5 µl/Test,left) or APC Rabbit anti-Mouse Foxp3 mAb (A27564,0.5 µg,right).