[KD Validated] FOXK1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A27583
Artikelname: [KD Validated] FOXK1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A27583
Hersteller Artikelnummer: A27583
Alternativnummer: ABB-A27583-100UL,ABB-A27583-20UL,ABB-A27583-500UL,ABB-A27583-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FOXK1L
Enables 14-3-3 protein binding activity, DNA-binding transcription repressor activity, RNA polymerase II-specific, and transcription cis-regulatory region binding activity. Involved in several processes, including cellular glucose homeostasis, negative regulation of autophagy, and regulation of transcription, DNA-templated. Located in cytoplasm and nucleus.
Molekulargewicht: 75kDa
NCBI: 221937
UniProt: P85037
Reinheit: Affinity purification
Sequenz: TVTILQPATPVTLGQHHLPVRAVTQNGKHAVPTNSLAGNAYALTSPLQLLATQASSSAPVVVTRVCEVGPKEPAAAVAATATTTPATATTASASASSTGEPEVKRSRVEEPSGAVTTPAGVIAAAGPQGPGTGE
Target-Kategorie: FOXK1
Application Verdünnung: WB,1:6000 - 1:24000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IF/ICC,1:200 - 1:400|IHC-P,1:2000 - 1:8000|ChIP,3µg antibody for 10µg-15µg of Chromatin|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentratio
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors.
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using [KD Validated] FOXK1 mAb (A27583) at a dilution of 1:6000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using [KD Validated] FOXK1 mAb (A27583) at a dilution of 1:6000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Western blot analysis of lysates from wild type (WT) and FOXK1 knockdown (KD) HeLa cells using [KD Validated] FOXK1 mAb (A27583) at 1:6000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using [KD Validated] FOXK1 mAb (A27583) at a dilution of 1:6000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using [KD Validated] FOXK1 mAb (A27583) at a dilution of 1:6000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of HeLa cells using [KD Validated] FOXK1 mAb (A27583, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Confocal imaging of NIH/3T3 cells using [KD Validated] FOXK1 mAb (A27583, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
Immunoprecipitation of from 300 µg extracts of Raji cells was performed using 2 µg of [KD Validated] FOXK1 Rabbit mAb (A27583). Rabbit Control IgG (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KD Validated] FOXK1 Rabbit mAb (A27583) at a dilution of 1:3000.
Chromatin immunoprecipitation was performed with 15 µg of cross-linked chromatin from 293F cells, using 3 µg of [KD Validated] FOXK1 mAb (A27583) and Rabbit IgG isotype control (AC042). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.