CDC25A Rabbit mAb, Unconjugated, Monoclonal

Produktübersicht

• Artikelname: CDC25A Rabbit mAb, Unconjugated, Monoclonal
• Artikelnummer: ABB-A27653
• Hersteller Artikelnummer: A27653
• Alternativnummer: ABB-A27653-1000UL,ABB-A27653-500UL,ABB-A27653-100UL,ABB-A27653-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CDC25A2

Produktbeschreibung

CDC25A is a member of the CDC25 family of phosphatases. CDC25A is required for progression from G1 to the S phase of the cell cycle. It activates the cyclin-dependent kinase CDC2 by removing two phosphate groups. CDC25A is specifically degraded in response to DNA damage, which prevents cells with chromosomal abnormalities from progressing through cell division. CDC25A is an oncogene, although its exact role in oncogenesis has not been demonstrated. Two transcript variants encoding different isoforms have been found for this gene.

Produkteigenschaften

• Klonalität: Monoclonal
• Molekulargewicht: 54kDa/59kDa
• NCBI: 993
• UniProt: P30304
• Reinheit: Affinity purification
• Sequenz: LIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPTDGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSYCEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
• Target-Kategorie: CDC25A

Anwendungsbeschreibung

• Application Verdünnung: WB,1:7000 - 1:42000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Cancer,Signal Transduction,Kinase,ATM Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Cell Cycle Control-G1 S Checkpoint,Cell Cycle Control-G2 M DNA Damage Checkpoint. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CDC25A Rabbit mAb (A27653) at 1:7000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.