ACAD8 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: ACAD8 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A27665
• Hersteller Artikelnummer: A27665
• Alternativnummer: ABB-A27665-500UL,ABB-A27665-100UL,ABB-A27665-20UL,ABB-A27665-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: IBDH, ARC42, ACAD-8

Produktbeschreibung

This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency.

Produkteigenschaften

• Molekulargewicht: 45kDa
• NCBI: 27034
• UniProt: Q9UKU7
• Reinheit: Affinity purification
• Sequenz: VQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRI
• Target-Kategorie: ACAD8

Anwendungsbeschreibung

• Application Verdünnung: WB,1:15000 - 1:90000|IHC-P,1:2000 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Lipid Metabolism.

Bilder

Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ACAD8 Rabbit mAb (A27665) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using ACAD8 RabbitmAb (A27665) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates using ACAD8 RabbitmAb (A27665) at 1:15000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using ACAD8 RabbitmAb (A27665) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using ACAD8 RabbitmAb (A27665) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse intestin tissue using ACAD8 RabbitmAb (A27665) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using ACAD8 RabbitmAb (A27665) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using ACAD8 RabbitmAb (A27665) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat pancreas tissue using ACAD8 RabbitmAb (A27665) at a dilution of 1:8000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.