MMP3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: MMP3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A27764
• Hersteller Artikelnummer: A27764
• Alternativnummer: ABB-A27764-100UL,ABB-A27764-20UL,ABB-A27764-500UL,ABB-A27764-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SL-1, STMY, STR1, CHDS6, MMP-3, STMY1

Produktbeschreibung

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMPs are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 54kDa
• NCBI: 17392
• UniProt: P28862
• Reinheit: Affinity purification
• Sequenz: VKKIDAAISNKEKRKTYFFVEDKYWRFDEKKQSMEPGFPRKIAEDFPGVDSRVDAVFEAFGFLYFFSGSSQLEFDPNAKKVTHILKSNSWFNC
• Target-Kategorie: MMP3

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1500 - 1:6000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Tumor biomarkers,Invasion and Metastasis,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Ubiquitin,Cardiovascular,Angiogenesis. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Mouse brain using MMP3 Rabbit pAb (A27764) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.