CD45RO Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CD45RO Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A27765
• Hersteller Artikelnummer: A27765
• Alternativnummer: ABB-A27765-100UL,ABB-A27765-500UL,ABB-A27765-1000UL,ABB-A27765-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: LCA, LY5, B220, CD45, L-CA, T200, CD45R, GP180, IMD105

Produktbeschreibung

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling. It functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. This PTP also suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Alternatively spliced transcripts variants of this gene, which encode distinct isoforms, have been reported.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 131kDa
• NCBI: 5788
• UniProt: P08575
• Reinheit: Affinity purification
• Sequenz: QSPTPSPTDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNL
• Target-Kategorie: PTPRC

Anwendungsbeschreibung

• Application Verdünnung: WB,1:5000 - 1:20000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs,B Cell Receptor Signaling Pathway,T Cell Receptor Signaling Pathway,Neuroscience, Cell Type Marker,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using CD45RO Rabbit pAb (A27765) at 1:5000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): 293T
Exposure time: 1s.