RIPK1/RIP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A27859
Artikelname: RIPK1/RIP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A27859
Hersteller Artikelnummer: A27859
Alternativnummer: ABB-A27859-500UL,ABB-A27859-1000UL,ABB-A27859-20UL,ABB-A27859-100UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: RIP, RIP1, AIEFL, IMD57, RIP-1
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein plays a role in inflammation and cell death in response to tissue damage, pathogen recognition, and as part of developmental regulation. RIPK1/RIPK3 kinase-mediated necrosis is referred to as necroptosis. Genetic disruption of this gene in mice results in death shortly after birth.
Klonalität: Polyclonal
Molekulargewicht: 75kDa
NCBI: 8737
UniProt: Q13546
Reinheit: Affinity purification
Sequenz: NNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN
Target-Kategorie: RIPK1
Application Verdünnung: WB,1:1000 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Kinase,Serine threonine kinases,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Death Receptor Signaling Pathway,Immunology Inflammation,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using RIPK1/RIP Rabbit pAb (A27859) at 1:2000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.