Calponin 1 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: Calponin 1 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A27934
• Hersteller Artikelnummer: A27934
• Alternativnummer: ABB-A27934-500UL,ABB-A27934-100UL,ABB-A27934-1000UL,ABB-A27934-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SMCC, Sm-Calp, HEL-S-14

Produktbeschreibung

Predicted to enable actin binding activity. Involved in negative regulation of vascular associated smooth muscle cell proliferation. Located in cytoskeleton.

Produkteigenschaften

• Molekulargewicht: 33kDa
• NCBI: 1264
• UniProt: P51911
• Reinheit: Affinity purification
• Sequenz: PLDQATISLQMGTNKGASQAGMTAPGTKRQIFEPGLGMEHCDTLNVSLQMGSNKGASQRGMTVYGLPRQVYDPKYCLTPEYPELGEPAHNHHAHNYYNSA
• Target-Kategorie: CNN1

Anwendungsbeschreibung

• Application Verdünnung: WB,1:5000 - 1:30000|IF-P,1:200 - 1:2000|IHC-P,1:2000 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Stem Cells,Mesenchymal Stem Cells,Cardiovascular.

Bilder

Western blot analysis of various lysates using Calponin 1 Rabbit mAb (A27934) at 1:5000 dilutionincubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): MDA-MB-231
Exposure time: 5s.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Calponin 1 Rabbit mAb (A27934) at a dilution of 1:7000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Calponin 1 Rabbit mAb (A27934) at a dilution of 1:7000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse intestine tissue using Calponin 1 Rabbit mAb (A27934) at a dilution of 1:7000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using Calponin 1 Rabbit mAb (A27934) at a dilution of 1:7000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of paraffin-embedded Human colon tissue using Calponin 1 Rabbit mAb (A27934, dilution 1:1000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Human colon cancer tissue using Calponin 1 Rabbit mAb (A27934, dilution 1:1000) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Mouse colon tissue using Calponin 1 Rabbit mAb (A27934, dilution 1:400) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Confocal imaging of paraffin-embedded Rat small intestine tissue using Calponin 1 Rabbit mAb (A27934, dilution 1:400) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.