[KD Validated] CDK2 Rabbit mAb, Unconjugated

Artikelname:	[KD Validated] CDK2 Rabbit mAb, Unconjugated
Artikelnummer:	ABB-A27938
Hersteller Artikelnummer:	A27938
Alternativnummer:	ABB-A27938-500UL,ABB-A27938-1000UL,ABB-A27938-100UL,ABB-A27938-20UL
Hersteller:	ABclonal
Wirt:	Rabbit
Kategorie:	Antikörper
Applikation:	ELISA, IF, IHC-P, WB
Spezies Reaktivität:	Human
Immunogen:	Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation:	Unconjugated
Alternative Synonym:	CDKN2, p33(CDK2)

This gene encodes a member of a family of serine/threonine protein kinases that participate in cell cycle regulation. The encoded protein is the catalytic subunit of the cyclin-dependent protein kinase complex, which regulates progression through the cell cycle. Activity of this protein is especially critical during the G1 to S phase transition. This protein associates with and regulated by other subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A), and p27Kip1 (CDKN1B). Alternative splicing results in multiple transcript variants.

Molekulargewicht:	30 kDa/34 kDa
NCBI:	1017
UniProt:	P24941
Reinheit:	Affinity purification
Sequenz:	RALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
Target-Kategorie:	CDK2

Application Verdünnung:	WB,1:4000 - 1:16000\|IF/ICC,1:200 - 1:400\|IF-P,1:200 - 1:400\|IHC-P,1:400 - 1:1600\|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. For high-ratio antibody dilutions (1:10000),
Anwendungsbeschreibung:	Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,ATM Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell Cycle Control-G1 S Checkpoint.

	Western blot analysis of lysates from wild type (WT) and CDK2 knockdown (KD) 293T cells using [KD Validated] CDK2 Rabbit mAb (A27938) at 1:8000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20 s.
	Western blot analysis of lysates from HeLa cells using [KD Validated] CDK2 Rabbit mAb (A27938) at 1:8000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20 s.
	Western blot analysis of various lysates using [KD Validated] CDK2 Rabbit mAb (A27938) at 1:8000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90 s.
	Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KD Validated] CDK2 Rabbit mAb (A27938) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using [KD Validated] CDK2 Rabbit mAb (A27938) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KD Validated] CDK2 Rabbit mAb (A27938) at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
	Confocal imaging of paraffin-embedded Mouse colon tissue using [KD Validated] CDK2 Rabbit mAb (A27938, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
	Confocal imaging of paraffin-embedded Rat colon tissue using [KD Validated] CDK2 Rabbit mAb (A27938, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
	Confocal imaging of HCT 116 cells using [KD Validated] CDK2 Rabbit mAb (A27938, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.