APC Rabbit anti-Mouse CD163 mAb, Monoclonal

Artikelnummer: ABB-A27963
Artikelname: APC Rabbit anti-Mouse CD163 mAb, Monoclonal
Artikelnummer: ABB-A27963
Hersteller Artikelnummer: A27963
Alternativnummer: ABB-A27963-25UG,ABB-A27963-100UG
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: APC
Alternative Synonym: CD163v2, CD163v3,M130
CD163 is a member of the Group B scavenger receptor cysteine-rich (SRCR) superfamily. It is also known as GHI/61, M130, RM3/1, p155, the hemoglobin-haptoglobin complex receptor, or macrophage-associated antigen.It is a glycoprotein with an apparent molecular weight of 134 kDa under non-reducing conditions and 155 kDa under reducing conditions. CD163 is predominantly expressed on macrophages, Kupffer cells, monocytes, subsets of dendritic cells, and subsets of hematopoietic stem/progenitor cells.CD163 binds the haptoglobin-hemoglobin (Hp-Hb) complex and TNF-like weak inducer of apoptosis (TWEAK). It serves as the receptor for hemoglobin scavenging and modulates cytokine production by macrophages.Membrane-bound CD163 can be proteolytically cleaved by metalloproteinases (e.g., ADAM17, MMPs), releasing its soluble form (sCD163). Elevated serum levels of sCD163 have been strongly associated with numerous inflammatory diseases.
Klonalität: Monoclonal
Konzentration: FC
Molekulargewicht: 121kDa/125kDa
NCBI: 93671
UniProt: Q2VLH6
Reinheit: Affinity purification
Sequenz: VTNAPGEMKKELRLAGGENNCSGRVELKIHDKWGTVCSNGWSMNEVSVVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEG
Target-Kategorie: Cd163
Application Verdünnung: FC, 0.5 µg per million cells in 100 µl volume
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,CDs,Cell Intrinsic Innate Immunity Signaling Pathway,Cardiovascular. Shipping: Ice Bag
Flow cytometry: 1X10 6 C57BL/6 mouse bone marrow cells were surface-stained with ABflo 450 Rabbit anti-Mouse CD11b (A26229,5 µl/Test) and APC Rabbit IgG isotype control (A24173,5 µl/Test,left) or APC Rabbit anti-Mouse CD163 mAb (A27963,0.5 µg,right).