ALDH3A1 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A27998
Artikelname: ALDH3A1 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A27998
Hersteller Artikelnummer: A27998
Alternativnummer: ABB-A27998-20UL,ABB-A27998-100UL,ABB-A27998-1000UL,ABB-A27998-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Rat
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: AHDC, Aldh, Ahd-c, Aldh3, Aldh3a1
Enables 3-chloroallyl aldehyde dehydrogenase activity. Involved in several processes, including response to cAMP, response to glucocorticoid, and response to hypoxia. Located in cytosol. Human ortholog(s) of this gene implicated in arteriosclerosis. Orthologous to human ALDH3A1 (aldehyde dehydrogenase 3 family member A1).
Molekulargewicht: 50kDa
NCBI: 25375
UniProt: P11883
Reinheit: Affinity purification
Sequenz: MSSISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALASDLGKNEWTSYYEEVAHVLEELDTTIKELPDWAEDEPVAKTRQTQQDDLYIHSE
Target-Kategorie: Aldh3a1
Application Verdünnung: WB,1:5000 - 1:20000|IF-P,1:200 - 1:800|IHC-P,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Signal Transduction Metabolism Energy MetabolismNeuroscience Sensory System Visual systemSignal Transduction Metabolism Alcohol metabolismCell Biology Other Antibodies Oxidative StressMetabolism Pathways and Processes Metabolic signaling pathways Alcohol metabolismMetabolism Pathways and Processes Metabolic signaling pathways Energy transfer pathways Energy MetabolismMetabolism Pathways and Processes Redox metabolism Oxidative stress
Western blot analysis of various lysates using ALDH3A1 Rabbit mAb (A27998) at 1:5000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): U-251 MG
Exposure time: 0.5s.
Western blot analysis of lysates from Rat lung using ALDH3A1 Rabbit mAb (A27998) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human stomach tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human cervix tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using ALDH3A1 Rabbit mAb (A27998) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Human stomach tissue using ALDH3A1 Rabbit mAb (A27998, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.