GPT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A2814
- Bilder (1)
| Artikelname: | GPT Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A2814 |
| Hersteller Artikelnummer: | A2814 |
| Alternativnummer: | ABB-A2814-1000UL,ABB-A2814-100UL,ABB-A2814-500UL,ABB-A2814-20UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ALT, AAT1, ALT1, GPT1, SGPT, GPT |
| This gene encodes cytosolic alanine aminotransaminase 1 (ALT1), also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 55kDa |
| NCBI: | 2875 |
| UniProt: | P24298 |
| Reinheit: | Affinity purification |
| Sequenz: | MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYP |
| Target-Kategorie: | GPT |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag |

