GPT Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: GPT Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2814
• Hersteller Artikelnummer: A2814
• Alternativnummer: ABB-A2814-1000UL,ABB-A2814-100UL,ABB-A2814-500UL,ABB-A2814-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: ALT, AAT1, ALT1, GPT1, SGPT, GPT

Produktbeschreibung

This gene encodes cytosolic alanine aminotransaminase 1 (ALT1), also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, plays a key role in the intermediary metabolism of glucose and amino acids. Serum activity levels of this enzyme are routinely used as a biomarker of liver injury caused by drug toxicity, infection, alcohol, and steatosis. A related gene on chromosome 16 encodes a putative mitochondrial alanine aminotransaminase.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 55kDa
• NCBI: 2875
• UniProt: P24298
• Reinheit: Affinity purification
• Sequenz: MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRTGVLIPIPQYP
• Target-Kategorie: GPT
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using GPT Rabbit pAb (A2814) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.