IFN-beta Rabbit mAb, Unconjugated, Monoclonal

Produktübersicht

• Artikelname: IFN-beta Rabbit mAb, Unconjugated, Monoclonal
• Artikelnummer: ABB-A28168
• Hersteller Artikelnummer: A28168
• Alternativnummer: ABB-A28168-500UL,ABB-A28168-100UL,ABB-A28168-20UL,ABB-A28168-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: IFB, IFF, IFNB, IFN-beta

Produktbeschreibung

This gene encodes a cytokine that belongs to the interferon family of signaling proteins, which are released as part of the innate immune response to pathogens. The protein encoded by this gene belongs to the type I class of interferons, which are important for defense against viral infections. In addition, type I interferons are involved in cell differentiation and anti-tumor defenses. Following secretion in response to a pathogen, type I interferons bind a homologous receptor complex and induce transcription of genes such as those encoding inflammatory cytokines and chemokines. Overactivation of type I interferon secretion is linked to autoimmune diseases. Mice deficient for this gene display several phenotypes including defects in B cell maturation and increased susceptibility to viral infection.

Produkteigenschaften

• Klonalität: Monoclonal
• Molekulargewicht: 22 kDa
• NCBI: 3456
• UniProt: P01574
• Reinheit: Affinity purification
• Sequenz: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
• Target-Kategorie: IFNB1

Anwendungsbeschreibung

• Application Verdünnung: WB,1:3000 - 1:10000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. For high-ratio antibody dilutions (1:10000),a sequential dilution method is strongly recommended to ensur
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors,Growth factors,Immunology Inflammation,Cytokines,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from THP-1 cells using IFN-beta Rabbit mAb (A28168) at 1:5000 dilutionincubated at room temperature for 1.5 hours. THP-1 cells were treated with PMA (80 nM) at 37°C for overnight, poly(dA:dT) (1 µg/mL) and BFA (300 ng/mL) for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45 s.