APC Rabbit anti-Human IgG (Fc) mAb, Monoclonal

Produktübersicht

• Artikelname: APC Rabbit anti-Human IgG (Fc) mAb, Monoclonal
• Artikelnummer: ABB-A28178
• Hersteller Artikelnummer: A28178
• Alternativnummer: ABB-A28178-100UG,ABB-A28178-50UG
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: APC
• Alternative Synonym: IGHG1

Produktbeschreibung

Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response, defense response to other organism, and phagocytosis. Predicted to act upstream of or within several processes, including immunoglobulin mediated immune response, positive regulation of hypersensitivity, and positive regulation of phagocytosis. Located in extracellular space.

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: FC
• Molekulargewicht: 36 kDa
• NCBI: 3500
• UniProt: P01857
• Reinheit: Affinity purification
• Sequenz: PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Target-Kategorie: IGHG1

Anwendungsbeschreibung

• Application Verdünnung: FC,0.25 µg per million cells in 100 µl volume
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation. Shipping: Ice Bag

Bilder

Flow cytometry:1X10 6 Human PBMC were surface-stained with ABflo 450 Rabbit anti-Human/Monkey CD19 mAb (A27286,5 µl/Test) and APC Rabbit IgG isotype control (A24173,5 µl/Test,left) or APC Rabbit anti-Human IgG(Fc) mAb (A28178,0.25 µg,right). Cells in the lymphocyte gate were used for analysis.