APC Rabbit anti-Human IgG (Fc) mAb, Monoclonal

Artikelnummer: ABB-A28178
Artikelname: APC Rabbit anti-Human IgG (Fc) mAb, Monoclonal
Artikelnummer: ABB-A28178
Hersteller Artikelnummer: A28178
Alternativnummer: ABB-A28178-100UG,ABB-A28178-50UG
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: APC
Alternative Synonym: IGHG1
Predicted to enable antigen binding activity and immunoglobulin receptor binding activity. Predicted to be involved in several processes, including activation of immune response, defense response to other organism, and phagocytosis. Predicted to act upstream of or within several processes, including immunoglobulin mediated immune response, positive regulation of hypersensitivity, and positive regulation of phagocytosis. Located in extracellular space.
Klonalität: Monoclonal
Konzentration: FC
Molekulargewicht: 36 kDa
NCBI: 3500
UniProt: P01857
Reinheit: Affinity purification
Sequenz: PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Target-Kategorie: IGHG1
Application Verdünnung: FC,0.25 µg per million cells in 100 µl volume
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Immunology Inflammation. Shipping: Ice Bag
Flow cytometry:1X10 6 Human PBMC were surface-stained with ABflo 450 Rabbit anti-Human/Monkey CD19 mAb (A27286,5 µl/Test) and APC Rabbit IgG isotype control (A24173,5 µl/Test,left) or APC Rabbit anti-Human IgG(Fc) mAb (A28178,0.25 µg,right). Cells in the lymphocyte gate were used for analysis.