ABflo 450 Rabbit anti-Mouse/Rat CD31/PECAM1 mAb, Monoclonal

Produktübersicht

• Artikelname: ABflo 450 Rabbit anti-Mouse/Rat CD31/PECAM1 mAb, Monoclonal
• Artikelnummer: ABB-A28212
• Hersteller Artikelnummer: A28212
• Alternativnummer: ABB-A28212-25UG,ABB-A28212-100UG
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC
• Spezies Reaktivität: Mouse, Rat
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: ABflo 450
• Alternative Synonym: Cd31, Pecam, PECAM-1

Produktbeschreibung

Predicted to enable protein homodimerization activity, protein phosphatase binding activity, and transmembrane signaling receptor activity. Acts upstream of or within several processes, including Rho protein signal transduction, endothelial cell morphogenesis, and positive regulation of tyrosine phosphorylation of STAT protein. Located in several cellular components, including cell-cell contact zone, external side of plasma membrane, and smooth muscle contractile fiber. Is expressed in several structures, including alimentary system, cardiovascular system, central nervous system, extraembryonic component, and genitourinary system. Human ortholog(s) of this gene implicated in coronary artery disease (multiple), lung non-small cell carcinoma, neuroblastoma, and psoriatic arthritis. Orthologous to human PECAM1 (platelet and endothelial cell adhesion molecule 1).

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: FC
• Molekulargewicht: 81 kDa
• NCBI: 18613
• UniProt: Q08481
• Reinheit: Affinity purification
• Sequenz: EENSFTINSIHMESLPSWEVMNGQQLTLECLVDISTTSKSRSQHRVLFYKDDAMVYNVTSREHTESYVIPQARVFHSGKYKCTVMLNNKEKTTIEYEVKVHGVSKPKVTLDKKEVTEGGVVTVNCSLQEEKPPIFFKIEKLEVGTKFVKRRIDKTSNENFVLMEFPIEAQDHVLVFRCQAGILSGFKLQESEPIRSEYVTVQE
• Target-Kategorie: Pecam1

Anwendungsbeschreibung

• Application Verdünnung: FC,0.5 µg per million cells in 100 µl volume
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Tumor immunology,Invasion and Metastasis,Signal Transduction,Cell Biology & Developmental Biology,Cell Adhesion,Cell Adhesion Molecules,Cytoskeleton,Immunology & Inflammation,CD markers,Stem Cells,Hematopoietic Progenitors,Mesenchymal Stem Cells,Cardiovascular,Angiogenesis,Blood. Shipping: Ice Bag

Bilder

Flow cytometry:1X10 6 C57BL/6 mouse splenocytes were surface-stained with ABflo 488 Rat anti-Mouse CD45R/B220 mAb (A27571,5 µl/Test) and ABflo450 Rabbit IgG isotype control (A27451,5 µl/Test,left) or ABflo 450 Rabbit anti-Mouse/Rat CD31/PECAM1 mAb (A28212,0.5 µg,right).