ABflo 488 Rabbit anti-Mouse CX3CR1 mAb, Monoclonal

Artikelnummer: ABB-A28253
Artikelname: ABflo 488 Rabbit anti-Mouse CX3CR1 mAb, Monoclonal
Artikelnummer: ABB-A28253
Hersteller Artikelnummer: A28253
Alternativnummer: ABB-A28253-25UG,ABB-A28253-100UG
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: FC
Spezies Reaktivität: Mouse
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: ABflo 488
Alternative Synonym: mCX3CR1
Enables C-X3-C chemokine binding activity and C-X3-C chemokine receptor activity. Involved in several processes, including antifungal innate immune response, central nervous system development, and synapse organization. Located in cell surface. Is expressed in several structures, including brain, colon, genitourinary system, head mesenchyme, and meninges. Used to study age related macular degeneration 12. Human ortholog(s) of this gene implicated in several diseases, including human immunodeficiency virus infectious disease, obesity, pulmonary hypertension, retinal disease (multiple), and systemic scleroderma. Orthologous to human CX3CR1 (C-X3-C motif chemokine receptor 1).
Klonalität: Monoclonal
Konzentration: FC
Molekulargewicht: 40 kDa
NCBI: 13051
UniProt: Q9Z0D9
Reinheit: Affinity purification
Sequenz: MSTSFPELDLENFEYDDSAEACYLGDIVAFGTIFLSVFYALVFTFGLVGNLLVVLALTNSRKPKSITDIYLLNLALSDLLFVATLPFWTHYLISHEGLHN
Target-Kategorie: Cx3cr1
Application Verdünnung: FC, 0.5 µg per million cells in 100 µl volume
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Cell Adhesion,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience. Shipping: Ice Bag
Flow cytometry:1X10 6 C57BL/6 mouse bone marrow cells were surface-stained with ABflo 450 Rabbit anti-Mouse CD11b mAb (A26229,5 µl/Test) and ABflo 488 Rabbit IgG isotype control (A22069,5 µl/Test,left) or ABflo 488 Rabbit anti-Mouse CX3CR1 mAb (A28253,0.5 µg,right).