NADPH oxidase 4 (NOX4) Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: NADPH oxidase 4 (NOX4) Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A28280
• Hersteller Artikelnummer: A28280
• Alternativnummer: ABB-A28280-500UL,ABB-A28280-20UL,ABB-A28280-1000UL,ABB-A28280-100UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: KOX, KOX-1, RENOX

Produktbeschreibung

This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 67 kDa
• NCBI: 50490
• UniProt: Q9JHI8
• Reinheit: Affinity purification
• Sequenz: KPVTIISVINHPSDVMELRMIKENFKARPGQYIILHCPSVSALENHPFTLTMCPTETKATFGVHFKVVGDWTERFRDLLLPPSSQDSEILPFIHSRNYPKLYIDGPFGSPFEESLNYE
• Target-Kategorie: NOX4

Anwendungsbeschreibung

• Application Verdünnung: WB,1:3000 - 1:12000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Drug metabolism,Immunology Inflammation,Cardiovascular,Blood,Heart,Cardiovascular diseases,Heart disease. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using NADPH oxidase 4 (NOX4) Rabbit pAb (A28280) at 1:5000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20 s.