ABflo 450 Rabbit anti-Mouse CD278/ICOS mAb, Monoclonal

Produktübersicht

• Artikelname: ABflo 450 Rabbit anti-Mouse CD278/ICOS mAb, Monoclonal
• Artikelnummer: ABB-A28296
• Hersteller Artikelnummer: A28296
• Alternativnummer: ABB-A28296-100UG,ABB-A28296-25UG
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: FC
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: ABflo 450
• Alternative Synonym: H4, CCLP, AILIM, CRP-1, Ly115

Produktbeschreibung

Predicted to be involved in T cell costimulation, T cell tolerance induction, and cell-cell adhesion. Located in external side of plasma membrane. Is integral component of plasma membrane. Used to study common variable immunodeficiency. Human ortholog(s) of this gene implicated in celiac disease, common variable immunodeficiency, and immunoglobulin alpha deficiency. Orthologous to human ICOS (inducible T cell costimulator).

Produkteigenschaften

• Klonalität: Monoclonal
• Konzentration: FC
• Molekulargewicht: 22 KDa
• NCBI: 54167
• UniProt: Q9WVS0
• Reinheit: Affinity purification
• Sequenz: EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL
• Target-Kategorie: Icos/CD278

Anwendungsbeschreibung

• Application Verdünnung: FC, 0.5 µg per million cells in 100 µl volume
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology Inflammation,CDs. Shipping: Ice Bag

Bilder

Flow cytometry: 1X10 6 C57BL/6 mouse splenocytes (untreated,left)and C57BL/6 mouse splenocytes (treated with anti-CD3/CD28 for 3 days,right) were surface-stained with ABflo 488 Rat anti-Mouse CD3 mAb (A27161,5 µl/Test) and ABflo 450 Rabbit anti-Mouse ICOS/CD278 mAb (A28296,0.5 µg).