TERT Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: TERT Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2979
• Hersteller Artikelnummer: A2979
• Alternativnummer: ABB-A2979-100UL,ABB-A2979-20UL,ABB-A2979-500UL,ABB-A2979-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TP2, TRT, CMM9, EST2, TCS1, hTRT, DKCA2, DKCB4, hEST2, PFBMFT1, TERT

Produktbeschreibung

Telomerase is a ribonucleoprotein polymerase that maintains telomere ends by addition of the telomere repeat TTAGGG. The enzyme consists of a protein component with reverse transcriptase activity, encoded by this gene, and an RNA component which serves as a template for the telomere repeat. Telomerase expression plays a role in cellular senescence, as it is normally repressed in postnatal somatic cells resulting in progressive shortening of telomeres. Deregulation of telomerase expression in somatic cells may be involved in oncogenesis. Studies in mouse suggest that telomerase also participates in chromosomal repair, since de novo synthesis of telomere repeats may occur at double-stranded breaks. Alternatively spliced variants encoding different isoforms of telomerase reverse transcriptase have been identified, the full-length sequence of some variants has not been determined. Alternative splicing at this locus is thought to be one mechanism of regulation of telomerase activity.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 127kDa
• NCBI: 7015
• UniProt: O14746
• Reinheit: Affinity purification
• Sequenz: NIYKILLLQAYRFHACVLQLPFHQQVWKNPTFFLRVISDTASLCYSILKAKNAGMSLGAKGAAGPLPSEAVQWLCHQAFLLKLTRHRVTYVPLLGSLRTAQ
• Target-Kategorie: TERT
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cancer,Tumor biomarkers,Cell Biology Developmental Biology,Stem Cells,Embryonic Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from HT-29 cells, using TERT Rabbit pAb (A2979) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.