B-Raf Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: B-Raf Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2988
• Hersteller Artikelnummer: A2988
• Alternativnummer: ABB-A2988-100UL,ABB-A2988-1000UL,ABB-A2988-500UL,ABB-A2988-20UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: NS7, B-raf, BRAF1, RAFB1, B-RAF1, BRAF-1, B-Raf

Produktbeschreibung

This gene encodes a protein belonging to the RAF family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERK signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene, most commonly the V600E mutation, are the most frequently identified cancer-causing mutations in melanoma, and have been identified in various other cancers as well, including non-Hodgkin lymphoma, colorectal cancer, thyroid carcinoma, non-small cell lung carcinoma, hairy cell leukemia and adenocarcinoma of lung. Mutations in this gene are also associated with cardiofaciocutaneous, Noonan, and Costello syndromes, which exhibit overlapping phenotypes. A pseudogene of this gene has been identified on the X chromosome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 84kDa
• NCBI: 673
• UniProt: P15056
• Reinheit: Affinity purification
• Sequenz: QKPIVRVFLPNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQEEASLAETALT
• Target-Kategorie: BRAF
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Kinase,Serine threonine kinases,Tyrosine kinases,ErbB-HER Signaling Pathway,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Inhibition of Apoptosis,Cell Cycle,Cell differentiation,ESC Pluripotency and Differentiation,Immunology Inflammation,T Cell Receptor Signaling Pathway,Jak-Stat-IL-6 Receptor Signaling Pathway,Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using B-Raf Rabbit pAb (A2988) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.