KCNC1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: KCNC1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2995
• Hersteller Artikelnummer: A2995
• Alternativnummer: ABB-A2995-1000UL,ABB-A2995-100UL,ABB-A2995-20UL,ABB-A2995-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: KV4, EPM7, NGK2, KV3.1, KCNC1

Produktbeschreibung

This gene encodes a member of a family of integral membrane proteins that mediate the voltage-dependent potassium ion permeability of excitable membranes. Alternative splicing is thought to result in two transcript variants encoding isoforms that differ at their C-termini. These isoforms have had conflicting names in the literature: the longer isoform has been called both b and alpha, while the shorter isoform has been called both a and beta (PMIDs 1432046, 12091563).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 58kDa
• NCBI: 3746
• UniProt: P48547
• Reinheit: Affinity purification
• Sequenz: MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETD
• Target-Kategorie: KCNC1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat liver, using KCNC1 Rabbit pAb (A2995) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.