TCF1/TCF7 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: TCF1/TCF7 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3091
• Hersteller Artikelnummer: A3091
• Alternativnummer: ABB-A3091-20UL,ABB-A3091-100UL,ABB-A3091-1000UL,ABB-A3091-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: TCF-1, TCF1/TCF7

Produktbeschreibung

This gene encodes a member of the T-cell factor/lymphoid enhancer-binding factor family of high mobility group (HMG) box transcriptional activators. This gene is expressed predominantly in T-cells and plays a critical role in natural killer cell and innate lymphoid cell development. The encoded protein forms a complex with beta-catenin and activates transcription through a Wnt/beta-catenin signaling pathway. Mice with a knockout of this gene are viable and fertile, but display a block in T-lymphocyte differentiation. Alternative splicing results in multiple transcript variants. Naturally-occurring isoforms lacking the N-terminal beta-catenin interaction domain may act as dominant negative regulators of Wnt signaling.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 42kDa
• NCBI: 6932
• UniProt: P36402
• Reinheit: Affinity purification
• Sequenz: ELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKA
• Target-Kategorie: TCF7
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Cell Adhesion,Wnt -Catenin Signaling Pathway,Immunology Inflammation,Stem Cells. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using TCF1/TCF7 Rabbit pAb (A3091) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.