HNF1alpha Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A3092
Artikelname: HNF1alpha Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A3092
Hersteller Artikelnummer: A3092
Alternativnummer: ABB-A3092-100UL,ABB-A3092-500UL,ABB-A3092-1000UL,ABB-A3092-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HNF1, LFB1, TCF1, HNF4A, MODY3, TCF-1, HNF-1A, IDDM20, HNF1alpha, HNF-1-alpha, HNF1alpha
The protein encoded by this gene is a transcription factor required for the expression of several liver-specific genes. The encoded protein functions as a homodimer and binds to the inverted palindrome 5-GTTAATNATTAAC-3. Defects in this gene are a cause of maturity onset diabetes of the young type 3 (MODY3) and also can result in the appearance of hepatic adenomas. Alternative splicing results in multiple transcript variants encoding different isoforms.
Klonalität: Polyclonal
Molekulargewicht: 67kDa
NCBI: 6927
UniProt: P20823
Reinheit: Affinity purification
Sequenz: LGEPGPYLLAGEGPLDKGESCGGGRGELAELPNGLGETRGSEDETDDDGEDFTPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQ
Target-Kategorie: HNF1A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Cell Adhesion,Wnt beta-Catenin Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using HNF1alpha Rabbit pAb (A3092) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.