FAM160B2 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: FAM160B2 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3192
• Hersteller Artikelnummer: A3192
• Alternativnummer: ABB-A3192-500UL,ABB-A3192-20UL,ABB-A3192-100UL,ABB-A3192-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: FAI16, RAI16, FAM160B2, RAM160B2

Produktbeschreibung

Able to activate MAPK/ERK and TGFB signaling pathways. May regulate the activity of genes involved in intestinal barrier function and immunoprotective inflammation (By similarity. May play a role in cell proliferation.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 82kDa
• NCBI: 64760
• UniProt: Q86V87
• Reinheit: Affinity purification
• Sequenz: DRQPEAPGDNPHTLYAHLIGHCDHLSDEISITTLRLFEELLQKPHEGIIHSLVLRNLEGRPYVAWGSPEPESYEDTLDLEEDPYFTDSFLDSGFQTPAKPR
• Target-Kategorie: FHIP2B
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using FAM160B2 Rabbit pAb (A3192) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.