FAM160B2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A3192
Artikelname: FAM160B2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A3192
Hersteller Artikelnummer: A3192
Alternativnummer: ABB-A3192-500UL,ABB-A3192-20UL,ABB-A3192-100UL,ABB-A3192-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: FAI16, RAI16, FAM160B2, RAM160B2
Able to activate MAPK/ERK and TGFB signaling pathways. May regulate the activity of genes involved in intestinal barrier function and immunoprotective inflammation (By similarity. May play a role in cell proliferation.
Klonalität: Polyclonal
Molekulargewicht: 82kDa
NCBI: 64760
UniProt: Q86V87
Reinheit: Affinity purification
Sequenz: DRQPEAPGDNPHTLYAHLIGHCDHLSDEISITTLRLFEELLQKPHEGIIHSLVLRNLEGRPYVAWGSPEPESYEDTLDLEEDPYFTDSFLDSGFQTPAKPR
Target-Kategorie: FHIP2B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using FAM160B2 Rabbit pAb (A3192) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.