[KO Validated] SMARCB1/SNF5 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: [KO Validated] SMARCB1/SNF5 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A3247
• Hersteller Artikelnummer: A3247
• Alternativnummer: ABB-A3247-20UL,ABB-A3247-100UL,ABB-A3247-500UL,ABB-A3247-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: RDT, CSS3, INI1, SNF5, Snr1, BAF47, INI-1, MRD15, RTPS1, Sfh1p, hSNFS, SNF5L1, SWNTS1, PPP1R144, F5

Produktbeschreibung

The protein encoded by this gene is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. This gene has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors. Alternatively spliced transcript variants have been found for this gene.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC53139]
• Molekulargewicht: 44kDa
• NCBI: 6598
• UniProt: Q12824
• Reinheit: Affinity purification
• Sequenz: LWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTT
• Target-Kategorie: SMARCB1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Apoptosis.

Bilder

Western blot analysis of lysates from wild type(WT) and SMARCB1/SNF5 Rabbit mAb knockout (KO) HeLa(KO) cells, using SMARCB1/SNF5 Rabbit mAb (A3247) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of paraffin-embedded Rat lung using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates, using SMARCB1/SNF5 Rabbit mAb (A3247) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:2000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of paraffin-embedded Mouse heart using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunoprecipitation of from 300 µg extracts of 293F cells was performed using 3 µg of [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at a dilution of 1:12000.

Immunohistochemistry analysis of paraffin-embedded Mouse heart using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human undifferentiated carcinoma of esophagus using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded HeLa and HeLa-SMARCB1-KO cells using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunoprecipitation of from 300 µg extracts of 293F cells was performed using 3 µg of [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KO Validated] SMARCB1/SNF5 Rabbit mAb (A3247) at a dilution of 1:12000.