NDUFC2 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: NDUFC2 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A3312
• Hersteller Artikelnummer: A3312
• Alternativnummer: ABB-A3312-100UL,ABB-A3312-20UL,ABB-A3312-1000UL,ABB-A3312-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: HLC-1, B14.5b, MC1DN36, NADHDH2, CI-B14.5b, NDUFC2

Produktbeschreibung

Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 14kDa
• NCBI: 4718
• UniProt: O95298
• Reinheit: Affinity purification
• Sequenz: MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDF
• Target-Kategorie: NDUFC2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases.

Bilder

Western blot analysis of lysates from A-549 cells, using NDUFC2 Rabbit pAb (A3312).
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.