NDUFC2 Rabbit pAb, Unconjugated

Artikelnummer: ABB-A3312
Artikelname: NDUFC2 Rabbit pAb, Unconjugated
Artikelnummer: ABB-A3312
Hersteller Artikelnummer: A3312
Alternativnummer: ABB-A3312-100UL,ABB-A3312-20UL,ABB-A3312-1000UL,ABB-A3312-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HLC-1, B14.5b, MC1DN36, NADHDH2, CI-B14.5b, NDUFC2
Involved in mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Part of mitochondrial respiratory chain complex I. Implicated in nuclear type mitochondrial complex I deficiency.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 4718
UniProt: O95298
Reinheit: Affinity purification
Sequenz: MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFAGYYLVKREDYLYAVRDREMFGYMKLHPEDF
Target-Kategorie: NDUFC2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Oxidative phosphorylation,Neuroscience,Neurodegenerative Diseases.
Western blot analysis of lysates from A-549 cells, using NDUFC2 Rabbit pAb (A3312).
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.