TMED9 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: TMED9 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3442
• Hersteller Artikelnummer: A3442
• Alternativnummer: ABB-A3442-100UL,ABB-A3442-20UL,ABB-A3442-500UL,ABB-A3442-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: p25, GMP25, p24a2, HSGP25L2G, p24alpha2, TMED9

Produktbeschreibung

This gene is a member of a family of genes encoding transport proteins located in the endoplasmic reticulum and the Golgi. A similar gene in mouse is the target of microRNA miR-296, which is part of an imprinted cluster.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 27kDa
• NCBI: 54732
• UniProt: Q9BVK6
• Reinheit: Affinity purification
• Sequenz: MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRH
• Target-Kategorie: TMED9
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using TMED9 Rabbit pAb (A3442) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.