SLITRK6 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SLITRK6 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3521
• Hersteller Artikelnummer: A3521
• Alternativnummer: ABB-A3521-100UL,ABB-A3521-20UL,ABB-A3521-1000UL,ABB-A3521-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: DFNMYP, SLITRK6

Produktbeschreibung

This gene encodes a member of the SLITRK protein family. Members of this family are integral membrane proteins that are characterized by two N-terminal leucine-rich repeat (LRR) domains and a C-terminal region that shares homology with trk neurotrophin receptors. This protein functions as a regulator of neurite outgrowth required for normal hearing and vision. Mutations in this gene are a cause of myopia and deafness.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 95kDa
• NCBI: 84189
• UniProt: Q9H5Y7
• Reinheit: Affinity purification
• Sequenz: IVFCAAGIVVLVLHRRRRYKKKQVDEQMRDNSPVHLQYSMYGHKTTHHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLVEQT
• Target-Kategorie: SLITRK6
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using SLITRK6 Rabbit pAb (A3521) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.