MXD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A3613
Artikelname: MXD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A3613
Hersteller Artikelnummer: A3613
Alternativnummer: ABB-A3613-20UL,ABB-A3613-100UL,ABB-A3613-1000UL,ABB-A3613-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MAD, MAD1, BHLHC58, MXD1
This gene encodes a member of the MYC/MAX/MAD network of basic helix-loop-helix leucine zipper transcription factors. The MYC/MAX/MAD transcription factors mediate cellular proliferation, differentiation and apoptosis. The encoded protein antagonizes MYC-mediated transcriptional activation of target genes by competing for the binding partner MAX and recruiting repressor complexes containing histone deacetylases. Mutations in this gene may play a role in acute leukemia, and the encoded protein is a potential tumor suppressor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Klonalität: Polyclonal
Molekulargewicht: 25kDa
NCBI: 4084
UniProt: Q05195
Reinheit: Affinity purification
Sequenz: KAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSSSSVSDSDERGSMQSLGSDEG
Target-Kategorie: MXD1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,MAPK-Erk Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using MXD1 Rabbit pAb (A3613) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.