PKD2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A3625
Artikelname: PKD2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A3625
Hersteller Artikelnummer: A3625
Alternativnummer: ABB-A3625-20UL,ABB-A3625-100UL,ABB-A3625-1000UL,ABB-A3625-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PC2, PKD4, Pc-2, APKD2, TRPP2, PKD2
This gene encodes a member of the polycystin protein family. The encoded protein is a multi-pass membrane protein that functions as a calcium permeable cation channel, and is involved in calcium transport and calcium signaling in renal epithelial cells. This protein interacts with polycystin 1, and they may be partners in a common signaling cascade involved in tubular morphogenesis. Mutations in this gene are associated with autosomal dominant polycystic kidney disease type 2.
Klonalität: Polyclonal
Molekulargewicht: 110kDa
NCBI: 5311
UniProt: Q13563
Reinheit: Affinity purification
Sequenz: EVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGGNGSSNVHV
Target-Kategorie: PKD2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Growth factors,Endocrine Metabolism,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using PKD2 Rabbit pAb (A3625) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.