FKBP51/FKBP5 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: FKBP51/FKBP5 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A3863
• Hersteller Artikelnummer: A3863
• Alternativnummer: ABB-A3863-100UL,ABB-A3863-20UL,ABB-A3863-500UL,ABB-A3863-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: P54, AIG6, FKBP51, FKBP54, PPIase, Ptg-10, FKBP51/FKBP5

Produktbeschreibung

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein. This gene has been found to have multiple polyadenylation sites. Alternative splicing results in multiple transcript variants.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 51kDa
• NCBI: 2289
• UniProt: Q13451
• Reinheit: Affinity purification
• Sequenz: ESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV
• Target-Kategorie: FKBP5
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Immunology Inflammation. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using FKBP51/FKBP5 Rabbit pAb (A3863) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.